PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009121136.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 475aa    MW: 52717.6 Da    PI: 5.7914
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009121136.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.6e-164996148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +l+d+vk++G g+W+t+ ++  + R++k+c++rw ++l
   XP_009121136.1 49 KGPWTSTEDGILIDYVKRHGEGNWNTVQKHTSLARCGKSCRLRWANHL 96
                     79******************************************9986 PP

2Myb_DNA-binding50.16.4e-16102145146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE++l+v+ ++++G++ W+  a++++ gRt++++k++w++
   XP_009121136.1 102 KGAFSKEEEQLIVEMHARMGNK-WAQMAEHLP-GRTDNEIKNYWNT 145
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.9274496IPR017930Myb domain
SuperFamilySSF466891.05E-2848143IPR009057Homeodomain-like
SMARTSM007177.6E-114898IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2250103IPR009057Homeodomain-like
CDDcd001673.12E-95196No hitNo description
PfamPF139216.6E-1552112No hitNo description
PROSITE profilePS5129425.07997151IPR017930Myb domain
SMARTSM007172.1E-16101149IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-24104150IPR009057Homeodomain-like
CDDcd001675.90E-12104145No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MVEREMSYTM VTDESDDAMY SSIYNESPSA ADNIGSGCTS RGKGSVLKKG PWTSTEDGIL  60
IDYVKRHGEG NWNTVQKHTS LARCGKSCRL RWANHLRPNL KKGAFSKEEE QLIVEMHARM  120
GNKWAQMAEH LPGRTDNEIK NYWNTRIKRR QRAGLPLYPP GTHVEDLHWS QEYHPSTSNV  180
TDRRRHQDIL QLGNSKANVL FDDLTFANVL FEDLNFATSL LPVASDISDM LGTGASSYMS  240
PILPSHSNIR QAFQSPEHFQ NAAPQKNPRS CSISDHPLYG NQHRTDVMIQ DSHHTFTDGM  300
VPTSKPLFGA VKLELPSFQY SEASGFDQWT TPSTPQSDLL DSVDTYIQSP PPLEIDEPDC  360
FSSCDTGLLD MLLHEAKIKA SAKHSFSSTT CATDGTQDVP RGGDTHNVTS GAGGNSSAFA  420
VVKTEELDQV WEPKRADVIR PDVLLESSWQ DQQSRFGIVR DSSSLNDALA LLLGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-32471505107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009121136.10.0PREDICTED: transcription factor GAMYB-like isoform X1
TrEMBLM4CCW10.0M4CCW1_BRARP; Uncharacterized protein
STRINGBra002042.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.10.0myb domain protein 65